Placeholder image of a protein
Icon representing a puzzle

1176: Revisiting Puzzle 124: PDZ Domain

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,453
  2. Avatar for Go Science 2. Go Science 76 pts. 9,443
  3. Avatar for Beta Folders 3. Beta Folders 56 pts. 9,415
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 9,376
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,340
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,297
  7. Avatar for Void Crushers 7. Void Crushers 14 pts. 9,287
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 9,255
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,250
  10. Avatar for Deleted group 10. Deleted group pts. 9,228
  1. Avatar for lamoille 161. lamoille Lv 1 1 pt. 8,628
  2. Avatar for 01010011111 162. 01010011111 Lv 1 1 pt. 8,622
  3. Avatar for asperger1993 163. asperger1993 Lv 1 1 pt. 8,619
  4. Avatar for BeckerM 164. BeckerM Lv 1 1 pt. 8,615
  5. Avatar for demeter900 165. demeter900 Lv 1 1 pt. 8,611
  6. Avatar for AryehK 166. AryehK Lv 1 1 pt. 8,606
  7. Avatar for DarkArrow58 167. DarkArrow58 Lv 1 1 pt. 8,594
  8. Avatar for wosser1 168. wosser1 Lv 1 1 pt. 8,591
  9. Avatar for Sedjenem 169. Sedjenem Lv 1 1 pt. 8,588
  10. Avatar for aspadistra 170. aspadistra Lv 1 1 pt. 8,579

Comments