Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,061
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,042
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 8,672
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,102
  6. Avatar for Deleted group 16. Deleted group pts. 7,610
  7. Avatar for EVHS AP Biology 17. EVHS AP Biology 1 pt. 5,276
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 4,910
  1. Avatar for Xothothor 91. Xothothor Lv 1 8 pts. 8,929
  2. Avatar for Deleted player 92. Deleted player pts. 8,918
  3. Avatar for goastano 93. goastano Lv 1 8 pts. 8,917
  4. Avatar for YeshuaLives 94. YeshuaLives Lv 1 8 pts. 8,889
  5. Avatar for PrettyPony2001 95. PrettyPony2001 Lv 1 7 pts. 8,889
  6. Avatar for TJOK fan 96. TJOK fan Lv 1 7 pts. 8,883
  7. Avatar for guineapig 97. guineapig Lv 1 7 pts. 8,877
  8. Avatar for Krashtak 98. Krashtak Lv 1 7 pts. 8,854
  9. Avatar for smholst 99. smholst Lv 1 6 pts. 8,850
  10. Avatar for Pro Lapser 100. Pro Lapser Lv 1 6 pts. 8,849

Comments