Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,061
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,042
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 8,672
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,102
  6. Avatar for Deleted group 16. Deleted group pts. 7,610
  7. Avatar for EVHS AP Biology 17. EVHS AP Biology 1 pt. 5,276
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 4,910
  1. Avatar for Tubby 151. Tubby Lv 1 1 pt. 7,980
  2. Avatar for ytsun0 152. ytsun0 Lv 1 1 pt. 7,893
  3. Avatar for Mike Lewis 153. Mike Lewis Lv 1 1 pt. 7,853
  4. Avatar for Dantoto 154. Dantoto Lv 1 1 pt. 7,847
  5. Avatar for isantheautumn 155. isantheautumn Lv 1 1 pt. 7,823
  6. Avatar for tela 156. tela Lv 1 1 pt. 7,701
  7. Avatar for lamoille 157. lamoille Lv 1 1 pt. 7,697
  8. Avatar for Jaco van As 158. Jaco van As Lv 1 1 pt. 7,630
  9. Avatar for mdipalo 159. mdipalo Lv 1 1 pt. 7,610
  10. Avatar for Tac1 160. Tac1 Lv 1 1 pt. 7,588

Comments