Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,061
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,042
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 8,672
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,102
  6. Avatar for Deleted group 16. Deleted group pts. 7,610
  7. Avatar for EVHS AP Biology 17. EVHS AP Biology 1 pt. 5,276
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 4,910
  1. Avatar for gcm24 11. gcm24 Lv 1 80 pts. 9,695
  2. Avatar for jermainiac 12. jermainiac Lv 1 78 pts. 9,692
  3. Avatar for gmn 13. gmn Lv 1 77 pts. 9,692
  4. Avatar for LociOiling 14. LociOiling Lv 1 75 pts. 9,690
  5. Avatar for crpainter 15. crpainter Lv 1 73 pts. 9,683
  6. Avatar for mimi 16. mimi Lv 1 71 pts. 9,682
  7. Avatar for justjustin 17. justjustin Lv 1 70 pts. 9,679
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 68 pts. 9,676
  9. Avatar for Galaxie 19. Galaxie Lv 1 67 pts. 9,667
  10. Avatar for Madde 20. Madde Lv 1 65 pts. 9,662

Comments