Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,061
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,042
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 8,672
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,102
  6. Avatar for Deleted group 16. Deleted group pts. 7,610
  7. Avatar for EVHS AP Biology 17. EVHS AP Biology 1 pt. 5,276
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 4,910
  1. Avatar for mirp 21. mirp Lv 1 63 pts. 9,662
  2. Avatar for frood66 22. frood66 Lv 1 62 pts. 9,661
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 60 pts. 9,653
  4. Avatar for johnmitch 24. johnmitch Lv 1 59 pts. 9,628
  5. Avatar for g_b 25. g_b Lv 1 58 pts. 9,621
  6. Avatar for grogar7 26. grogar7 Lv 1 56 pts. 9,618
  7. Avatar for Deleted player 27. Deleted player pts. 9,606
  8. Avatar for KarenCH 28. KarenCH Lv 1 53 pts. 9,603
  9. Avatar for gloverd 29. gloverd Lv 1 52 pts. 9,601
  10. Avatar for christioanchauvin 30. christioanchauvin Lv 1 51 pts. 9,574

Comments