Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 9,114
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 9,061
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,042
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 8,672
  5. Avatar for SETI.Germany 15. SETI.Germany 1 pt. 8,102
  6. Avatar for Deleted group 16. Deleted group pts. 7,610
  7. Avatar for EVHS AP Biology 17. EVHS AP Biology 1 pt. 5,276
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 4,910
  1. Avatar for steveB 41. steveB Lv 1 38 pts. 9,494
  2. Avatar for actiasluna 42. actiasluna Lv 1 37 pts. 9,494
  3. Avatar for alcor29 43. alcor29 Lv 1 36 pts. 9,484
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 35 pts. 9,483
  5. Avatar for spvincent 45. spvincent Lv 1 34 pts. 9,480
  6. Avatar for pmdpmd 46. pmdpmd Lv 1 33 pts. 9,467
  7. Avatar for tarimo 47. tarimo Lv 1 33 pts. 9,453
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 32 pts. 9,452
  9. Avatar for nicobul 49. nicobul Lv 1 31 pts. 9,452
  10. Avatar for Glen B 50. Glen B Lv 1 30 pts. 9,434

Comments