Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups


  1. Avatar for Contenders 100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326

  1. Avatar for Mark-
    1. Mark- Lv 1
    100 pts. 9,895
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 98 pts. 9,807
  3. Avatar for Susume 3. Susume Lv 1 96 pts. 9,806
  4. Avatar for bertro 4. bertro Lv 1 94 pts. 9,764
  5. Avatar for phi16 5. phi16 Lv 1 92 pts. 9,759
  6. Avatar for MurloW 6. MurloW Lv 1 90 pts. 9,747
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 88 pts. 9,746
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 86 pts. 9,715
  9. Avatar for gitwut 9. gitwut Lv 1 84 pts. 9,698
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 82 pts. 9,698

Comments