Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups


  1. Avatar for Contenders 100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326

  1. Avatar for gcm24 11. gcm24 Lv 1 80 pts. 9,695
  2. Avatar for jermainiac 12. jermainiac Lv 1 78 pts. 9,692
  3. Avatar for gmn 13. gmn Lv 1 77 pts. 9,692
  4. Avatar for LociOiling 14. LociOiling Lv 1 75 pts. 9,690
  5. Avatar for crpainter 15. crpainter Lv 1 73 pts. 9,683
  6. Avatar for mimi 16. mimi Lv 1 71 pts. 9,682
  7. Avatar for justjustin 17. justjustin Lv 1 70 pts. 9,679
  8. Avatar for dcrwheeler 18. dcrwheeler Lv 1 68 pts. 9,676
  9. Avatar for Galaxie 19. Galaxie Lv 1 67 pts. 9,667
  10. Avatar for Madde 20. Madde Lv 1 65 pts. 9,662

Comments