Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups


  1. Avatar for Contenders 100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326

  1. Avatar for steveB 41. steveB Lv 1 38 pts. 9,494
  2. Avatar for actiasluna 42. actiasluna Lv 1 37 pts. 9,494
  3. Avatar for alcor29 43. alcor29 Lv 1 36 pts. 9,484
  4. Avatar for Anfinsen_slept_here 44. Anfinsen_slept_here Lv 1 35 pts. 9,483
  5. Avatar for spvincent 45. spvincent Lv 1 34 pts. 9,480
  6. Avatar for pmdpmd 46. pmdpmd Lv 1 33 pts. 9,467
  7. Avatar for tarimo 47. tarimo Lv 1 33 pts. 9,453
  8. Avatar for WBarme1234 48. WBarme1234 Lv 1 32 pts. 9,452
  9. Avatar for nicobul 49. nicobul Lv 1 31 pts. 9,452
  10. Avatar for Glen B 50. Glen B Lv 1 30 pts. 9,434

Comments