Placeholder image of a protein
Icon representing a puzzle

1177: Unsolved De-novo Freestyle 63

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
December 23, 2015
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RKVEKLLREFEKEIKEISKGKKTSYRFEIRVSEGDIEIEFEITTTGIRVRIRIGKGNYDTEIEIRGSSSGQDMLKLLEEVLKEIKKYIKN

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 9,921
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,878
  3. Avatar for Go Science 3. Go Science 54 pts. 9,807
  4. Avatar for Beta Folders 4. Beta Folders 38 pts. 9,764
  5. Avatar for Gargleblasters 5. Gargleblasters 27 pts. 9,715
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,698
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,574
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,565
  9. Avatar for Deleted group 9. Deleted group pts. 9,483
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,326
  1. Avatar for thkl 181. thkl Lv 1 1 pt. 7,176
  2. Avatar for metafolder 182. metafolder Lv 1 1 pt. 7,165
  3. Avatar for bcmccjr01 183. bcmccjr01 Lv 1 1 pt. 7,073
  4. Avatar for pandabearsecond 184. pandabearsecond Lv 1 1 pt. 6,921
  5. Avatar for Morpheox 185. Morpheox Lv 1 1 pt. 6,907
  6. Avatar for brgreening 186. brgreening Lv 1 1 pt. 6,885
  7. Avatar for Cerzax 187. Cerzax Lv 1 1 pt. 6,885
  8. Avatar for gruener-zwer 188. gruener-zwer Lv 1 1 pt. 6,869
  9. Avatar for SALiquidSilver 189. SALiquidSilver Lv 1 1 pt. 6,813
  10. Avatar for RJ Shirey 190. RJ Shirey Lv 1 1 pt. 6,489

Comments