Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,904
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,767
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,728
  4. Avatar for foldeRNA 14. foldeRNA 1 pt. 8,541
  5. Avatar for xkcd 15. xkcd 1 pt. 8,365
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,293
  7. Avatar for Team Germany 17. Team Germany 1 pt. 8,256
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,162
  9. Avatar for FoldIt@Netherlands 19. FoldIt@Netherlands 1 pt. 7,881
  1. Avatar for sheerbliss 31. sheerbliss Lv 1 52 pts. 8,946
  2. Avatar for crpainter 32. crpainter Lv 1 51 pts. 8,946
  3. Avatar for Skippysk8s 33. Skippysk8s Lv 1 50 pts. 8,944
  4. Avatar for mimi 34. mimi Lv 1 49 pts. 8,944
  5. Avatar for Paulo Roque 35. Paulo Roque Lv 1 48 pts. 8,942
  6. Avatar for Museka 36. Museka Lv 1 47 pts. 8,938
  7. Avatar for g_b 37. g_b Lv 1 46 pts. 8,935
  8. Avatar for lynnai 38. lynnai Lv 1 44 pts. 8,931
  9. Avatar for caglar 39. caglar Lv 1 43 pts. 8,926
  10. Avatar for gloverd 40. gloverd Lv 1 42 pts. 8,925

Comments