Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909

  1. Avatar for dbuske 21. dbuske Lv 1 1 pt. 8,964
  2. Avatar for Superphosphate 22. Superphosphate Lv 1 1 pt. 8,962
  3. Avatar for frood66 23. frood66 Lv 1 1 pt. 8,959
  4. Avatar for ViJay7019 24. ViJay7019 Lv 1 1 pt. 8,957
  5. Avatar for phi16 25. phi16 Lv 1 1 pt. 8,957
  6. Avatar for dettingen 26. dettingen Lv 1 1 pt. 8,956
  7. Avatar for MaartenDesnouck 27. MaartenDesnouck Lv 1 1 pt. 8,956
  8. Avatar for gmn 28. gmn Lv 1 1 pt. 8,956
  9. Avatar for lamoille 29. lamoille Lv 1 1 pt. 8,956
  10. Avatar for mimi 30. mimi Lv 1 1 pt. 8,956

Comments