Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909

  1. Avatar for Festering Wounds 111. Festering Wounds Lv 1 5 pts. 8,750
  2. Avatar for CelloP 112. CelloP Lv 1 5 pts. 8,750
  3. Avatar for ecali 113. ecali Lv 1 5 pts. 8,750
  4. Avatar for Mydogisa Toelicker 114. Mydogisa Toelicker Lv 1 5 pts. 8,749
  5. Avatar for Mohambone 115. Mohambone Lv 1 5 pts. 8,749
  6. Avatar for NameChangeNeeded01 116. NameChangeNeeded01 Lv 1 5 pts. 8,747
  7. Avatar for Ernst Zundel 117. Ernst Zundel Lv 1 4 pts. 8,744
  8. Avatar for Terafold 118. Terafold Lv 1 4 pts. 8,739
  9. Avatar for ppp6 119. ppp6 Lv 1 4 pts. 8,734
  10. Avatar for leehaggis 120. leehaggis Lv 1 4 pts. 8,733

Comments