Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909

  1. Avatar for Radeodem8 171. Radeodem8 Lv 1 1 pt. 8,382
  2. Avatar for proteansoup 172. proteansoup Lv 1 1 pt. 8,382
  3. Avatar for GreekCivilization 173. GreekCivilization Lv 1 1 pt. 8,378
  4. Avatar for brgreening 174. brgreening Lv 1 1 pt. 8,375
  5. Avatar for demeter900 175. demeter900 Lv 1 1 pt. 8,374
  6. Avatar for DScott 176. DScott Lv 1 1 pt. 8,365
  7. Avatar for fryguy 177. fryguy Lv 1 1 pt. 8,365
  8. Avatar for BeckerM 178. BeckerM Lv 1 1 pt. 8,342
  9. Avatar for 01010011111 179. 01010011111 Lv 1 1 pt. 8,339
  10. Avatar for parsnip 180. parsnip Lv 1 1 pt. 8,339

Comments