Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909

  1. Avatar for asperger1993 181. asperger1993 Lv 1 1 pt. 8,331
  2. Avatar for maanasa_honbio 182. maanasa_honbio Lv 1 1 pt. 8,325
  3. Avatar for sonucg123 183. sonucg123 Lv 1 1 pt. 8,311
  4. Avatar for bcd 184. bcd Lv 1 1 pt. 8,305
  5. Avatar for smhirt 185. smhirt Lv 1 1 pt. 8,305
  6. Avatar for Poko18 186. Poko18 Lv 1 1 pt. 8,304
  7. Avatar for Psych0Active 187. Psych0Active Lv 1 1 pt. 8,302
  8. Avatar for Voltozan 188. Voltozan Lv 1 1 pt. 8,296
  9. Avatar for aspadistra 189. aspadistra Lv 1 1 pt. 8,293
  10. Avatar for Krashtak 190. Krashtak Lv 1 1 pt. 8,291

Comments