Placeholder image of a protein
Icon representing a puzzle

1178: Revisiting Puzzle 125: Ice Binding

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 05, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Go Science 100 pts. 9,015
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 9,004
  3. Avatar for Italiani Al Lavoro 3. Italiani Al Lavoro 56 pts. 8,979
  4. Avatar for Contenders 4. Contenders 41 pts. 8,978
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 29 pts. 8,976
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 8,976
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 8,972
  8. Avatar for Void Crushers 8. Void Crushers 9 pts. 8,950
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 8,950
  10. Avatar for BOINC@Poland 10. BOINC@Poland 4 pts. 8,909

  1. Avatar for Tac1 221. Tac1 Lv 1 1 pt. 8,119
  2. Avatar for Valerio Zenatti 222. Valerio Zenatti Lv 1 1 pt. 8,099
  3. Avatar for Sedjenem 223. Sedjenem Lv 1 1 pt. 8,092
  4. Avatar for fstratzero 224. fstratzero Lv 1 1 pt. 8,055
  5. Avatar for nagistick 225. nagistick Lv 1 1 pt. 8,055
  6. Avatar for ivalnic 226. ivalnic Lv 1 1 pt. 8,053
  7. Avatar for bendbob 227. bendbob Lv 1 1 pt. 8,045
  8. Avatar for cbwest 228. cbwest Lv 1 1 pt. 8,003
  9. Avatar for enfancedejade 229. enfancedejade Lv 1 1 pt. 7,997
  10. Avatar for S craft 161 230. S craft 161 Lv 1 1 pt. 7,969

Comments