Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,263
  2. Avatar for lamoille 2. lamoille Lv 1 88 pts. 9,237
  3. Avatar for viosca 3. viosca Lv 1 77 pts. 9,199
  4. Avatar for gmn 4. gmn Lv 1 68 pts. 9,197
  5. Avatar for hansvandenhof 5. hansvandenhof Lv 1 59 pts. 9,195
  6. Avatar for MaartenDesnouck 6. MaartenDesnouck Lv 1 51 pts. 9,195
  7. Avatar for alwen 7. alwen Lv 1 44 pts. 9,192
  8. Avatar for alcor29 8. alcor29 Lv 1 38 pts. 9,190
  9. Avatar for phi16 9. phi16 Lv 1 32 pts. 9,190
  10. Avatar for smilingone 10. smilingone Lv 1 27 pts. 9,176

Comments