Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for JUMELLE54 91. JUMELLE54 Lv 1 9 pts. 8,619
  2. Avatar for Deleted player 92. Deleted player 9 pts. 8,605
  3. Avatar for Auntecedent 93. Auntecedent Lv 1 9 pts. 8,602
  4. Avatar for Festering Wounds 94. Festering Wounds Lv 1 8 pts. 8,599
  5. Avatar for hada 95. hada Lv 1 8 pts. 8,598
  6. Avatar for 01010011111 96. 01010011111 Lv 1 8 pts. 8,589
  7. Avatar for bendbob 97. bendbob Lv 1 7 pts. 8,588
  8. Avatar for dahast.de 98. dahast.de Lv 1 7 pts. 8,581
  9. Avatar for YeshuaLives 99. YeshuaLives Lv 1 7 pts. 8,576
  10. Avatar for mitarcher 100. mitarcher Lv 1 7 pts. 8,576

Comments