Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for cbwest 111. cbwest Lv 1 5 pts. 8,534
  2. Avatar for harvardman 112. harvardman Lv 1 4 pts. 8,530
  3. Avatar for TJOK fan 113. TJOK fan Lv 1 4 pts. 8,521
  4. Avatar for Pro Lapser 114. Pro Lapser Lv 1 4 pts. 8,521
  5. Avatar for heather-1 115. heather-1 Lv 1 4 pts. 8,519
  6. Avatar for Merf 116. Merf Lv 1 4 pts. 8,506
  7. Avatar for navn 117. navn Lv 1 4 pts. 8,500
  8. Avatar for Bushman 118. Bushman Lv 1 3 pts. 8,500
  9. Avatar for gurch 119. gurch Lv 1 3 pts. 8,490
  10. Avatar for bcd 120. bcd Lv 1 3 pts. 8,489

Comments