Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956

  1. Avatar for dbuske 151. dbuske Lv 1 1 pt. 8,180
  2. Avatar for Inkedhands 152. Inkedhands Lv 1 1 pt. 8,142
  3. Avatar for molleke 153. molleke Lv 1 1 pt. 8,135
  4. Avatar for Restartbob 154. Restartbob Lv 1 1 pt. 8,129
  5. Avatar for Gamer_Fenomenal 155. Gamer_Fenomenal Lv 1 1 pt. 8,077
  6. Avatar for senor pit 156. senor pit Lv 1 1 pt. 8,076
  7. Avatar for Iron pet 157. Iron pet Lv 1 1 pt. 8,066
  8. Avatar for Shakatir 158. Shakatir Lv 1 1 pt. 8,064
  9. Avatar for t1mn 159. t1mn Lv 1 1 pt. 8,043
  10. Avatar for PrettyPony2001 160. PrettyPony2001 Lv 1 1 pt. 8,042

Comments