Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for boondog 181. boondog Lv 1 1 pt. 7,510
  2. Avatar for cnhrcolemam 182. cnhrcolemam Lv 1 1 pt. 7,504
  3. Avatar for uihcv 183. uihcv Lv 1 1 pt. 7,503
  4. Avatar for Tac1 184. Tac1 Lv 1 1 pt. 7,483
  5. Avatar for pandabearsecond 185. pandabearsecond Lv 1 1 pt. 7,457
  6. Avatar for Thegood 186. Thegood Lv 1 1 pt. 7,400
  7. Avatar for DScott 187. DScott Lv 1 1 pt. 7,315
  8. Avatar for Mike Lewis 188. Mike Lewis Lv 1 1 pt. 7,305
  9. Avatar for Manderson7 189. Manderson7 Lv 1 1 pt. 7,296
  10. Avatar for g-artemov 190. g-artemov Lv 1 1 pt. 7,287

Comments