Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for TheStupid 191. TheStupid Lv 1 1 pt. 7,219
  2. Avatar for jjoeyy1 192. jjoeyy1 Lv 1 1 pt. 7,201
  3. Avatar for maria_pl 193. maria_pl Lv 1 1 pt. 7,119
  4. Avatar for mvronsky 194. mvronsky Lv 1 1 pt. 6,983
  5. Avatar for brgreening 195. brgreening Lv 1 1 pt. 6,957
  6. Avatar for Sydefecks 196. Sydefecks Lv 1 1 pt. 6,919
  7. Avatar for Wheeler22 197. Wheeler22 Lv 1 1 pt. 6,910
  8. Avatar for Albatross795 198. Albatross795 Lv 1 1 pt. 6,909
  9. Avatar for Freemty 199. Freemty Lv 1 1 pt. 6,889
  10. Avatar for penteplayer 200. penteplayer Lv 1 1 pt. 6,862

Comments