Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956

  1. Avatar for odd135 221. odd135 Lv 1 1 pt. 4,677
  2. Avatar for agnairt 222. agnairt Lv 1 1 pt. 924
  3. Avatar for Alladin 223. Alladin Lv 1 1 pt. 0
  4. Avatar for BeckerM 224. BeckerM Lv 1 1 pt. 0
  5. Avatar for honzikjk 225. honzikjk Lv 1 1 pt. 0
  6. Avatar for benjy33 226. benjy33 Lv 1 1 pt. 0
  7. Avatar for Primalsoul 227. Primalsoul Lv 1 1 pt. 0
  8. Avatar for packer 228. packer Lv 1 1 pt. 0
  9. Avatar for bkoep 229. bkoep Lv 1 1 pt. 0

Comments