Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for johnmitch 21. johnmitch Lv 1 64 pts. 9,006
  2. Avatar for Bruno Kestemont 22. Bruno Kestemont Lv 1 63 pts. 9,005
  3. Avatar for Deleted player 23. Deleted player pts. 9,003
  4. Avatar for Blipperman 24. Blipperman Lv 1 60 pts. 8,994
  5. Avatar for nicobul 25. nicobul Lv 1 58 pts. 8,991
  6. Avatar for hpaege 26. hpaege Lv 1 57 pts. 8,991
  7. Avatar for actiasluna 27. actiasluna Lv 1 56 pts. 8,986
  8. Avatar for justjustin 28. justjustin Lv 1 54 pts. 8,985
  9. Avatar for gloverd 29. gloverd Lv 1 53 pts. 8,966
  10. Avatar for gmn 30. gmn Lv 1 52 pts. 8,965

Comments