Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for Museka 61. Museka Lv 1 23 pts. 8,798
  2. Avatar for Datstandin 62. Datstandin Lv 1 22 pts. 8,785
  3. Avatar for silverberg 63. silverberg Lv 1 22 pts. 8,780
  4. Avatar for Mark- 64. Mark- Lv 1 21 pts. 8,777
  5. Avatar for andrewxc 65. andrewxc Lv 1 20 pts. 8,767
  6. Avatar for hallenberg 66. hallenberg Lv 1 20 pts. 8,766
  7. Avatar for alcor29 67. alcor29 Lv 1 19 pts. 8,763
  8. Avatar for deLaCeiba 68. deLaCeiba Lv 1 19 pts. 8,759
  9. Avatar for steveB 69. steveB Lv 1 18 pts. 8,738
  10. Avatar for arginia 70. arginia Lv 1 18 pts. 8,733

Comments