Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 8,759
  2. Avatar for xkcd 12. xkcd 1 pt. 8,703
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,361
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,135
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 6,784
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 6,269
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 5,956
  1. Avatar for caglar 71. caglar Lv 1 17 pts. 8,732
  2. Avatar for jamiexq 72. jamiexq Lv 1 17 pts. 8,711
  3. Avatar for Vinara 73. Vinara Lv 1 16 pts. 8,710
  4. Avatar for manu8170 74. manu8170 Lv 1 16 pts. 8,709
  5. Avatar for georg137 75. georg137 Lv 1 15 pts. 8,704
  6. Avatar for fryguy 76. fryguy Lv 1 15 pts. 8,703
  7. Avatar for WarpSpeed 77. WarpSpeed Lv 1 14 pts. 8,688
  8. Avatar for jobo0502 78. jobo0502 Lv 1 14 pts. 8,671
  9. Avatar for stomjoh 79. stomjoh Lv 1 13 pts. 8,670
  10. Avatar for alwen 80. alwen Lv 1 13 pts. 8,669

Comments