Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830

  1. Avatar for TheStupid 191. TheStupid Lv 1 1 pt. 7,219
  2. Avatar for jjoeyy1 192. jjoeyy1 Lv 1 1 pt. 7,201
  3. Avatar for maria_pl 193. maria_pl Lv 1 1 pt. 7,119
  4. Avatar for mvronsky 194. mvronsky Lv 1 1 pt. 6,983
  5. Avatar for brgreening 195. brgreening Lv 1 1 pt. 6,957
  6. Avatar for Sydefecks 196. Sydefecks Lv 1 1 pt. 6,919
  7. Avatar for Wheeler22 197. Wheeler22 Lv 1 1 pt. 6,910
  8. Avatar for Albatross795 198. Albatross795 Lv 1 1 pt. 6,909
  9. Avatar for Freemty 199. Freemty Lv 1 1 pt. 6,889
  10. Avatar for penteplayer 200. penteplayer Lv 1 1 pt. 6,862

Comments