Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830

  1. Avatar for caglar 71. caglar Lv 1 17 pts. 8,732
  2. Avatar for jamiexq 72. jamiexq Lv 1 17 pts. 8,711
  3. Avatar for Vinara 73. Vinara Lv 1 16 pts. 8,710
  4. Avatar for manu8170 74. manu8170 Lv 1 16 pts. 8,709
  5. Avatar for georg137 75. georg137 Lv 1 15 pts. 8,704
  6. Avatar for fryguy 76. fryguy Lv 1 15 pts. 8,703
  7. Avatar for WarpSpeed 77. WarpSpeed Lv 1 14 pts. 8,688
  8. Avatar for jobo0502 78. jobo0502 Lv 1 14 pts. 8,671
  9. Avatar for stomjoh 79. stomjoh Lv 1 13 pts. 8,670
  10. Avatar for alwen 80. alwen Lv 1 13 pts. 8,669

Comments