Placeholder image of a protein
Icon representing a puzzle

1181: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 3 pts. 8,774
  2. Avatar for BOINC@Poland 12. BOINC@Poland 2 pts. 8,733
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,690
  4. Avatar for freefolder 14. freefolder 1 pt. 8,601
  5. Avatar for It's over 9000! 15. It's over 9000! 1 pt. 8,589
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 8,534
  7. Avatar for Deleted group 17. Deleted group pts. 7,638
  8. Avatar for uneRx 18. uneRx 1 pt. 7,617
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,452
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,214

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,413
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 98 pts. 9,291
  3. Avatar for frood66 3. frood66 Lv 1 96 pts. 9,243
  4. Avatar for bertro 5. bertro Lv 1 93 pts. 9,227
  5. Avatar for retiredmichael 6. retiredmichael Lv 1 91 pts. 9,218
  6. Avatar for mimi 7. mimi Lv 1 89 pts. 9,210
  7. Avatar for reefyrob 8. reefyrob Lv 1 87 pts. 9,202
  8. Avatar for gitwut 9. gitwut Lv 1 85 pts. 9,184
  9. Avatar for dcrwheeler 10. dcrwheeler Lv 1 83 pts. 9,182

Comments