Placeholder image of a protein
Icon representing a puzzle

1181: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,413
  2. Avatar for Go Science 2. Go Science 77 pts. 9,291
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,249
  4. Avatar for Deleted group 4. Deleted group pts. 9,228
  5. Avatar for Contenders 5. Contenders 31 pts. 9,210
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 22 pts. 9,175
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 9,146
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 9,121
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,024
  10. Avatar for xkcd 10. xkcd 5 pts. 8,851

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 9,410
  2. Avatar for Deleted player 2. Deleted player pts. 9,408
  3. Avatar for Deleted player 3. Deleted player 75 pts. 9,404
  4. Avatar for reefyrob 4. reefyrob Lv 1 64 pts. 9,387
  5. Avatar for bertro 5. bertro Lv 1 55 pts. 9,387
  6. Avatar for LociOiling 6. LociOiling Lv 1 47 pts. 9,380
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 40 pts. 9,352
  8. Avatar for Paulo Roque 8. Paulo Roque Lv 1 33 pts. 9,291
  9. Avatar for gloverd 9. gloverd Lv 1 28 pts. 9,290
  10. Avatar for diamond_dust 10. diamond_dust Lv 1 23 pts. 9,288

Comments