Placeholder image of a protein
Icon representing a puzzle

1181: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 13, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,413
  2. Avatar for Go Science 2. Go Science 77 pts. 9,291
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 9,249
  4. Avatar for Deleted group 4. Deleted group pts. 9,228
  5. Avatar for Contenders 5. Contenders 31 pts. 9,210
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 22 pts. 9,175
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 9,146
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 11 pts. 9,121
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 9,024
  10. Avatar for xkcd 10. xkcd 5 pts. 8,851

  1. Avatar for Paulo Roque 31. Paulo Roque Lv 1 52 pts. 9,038
  2. Avatar for tallguy-13088 32. tallguy-13088 Lv 1 51 pts. 9,035
  3. Avatar for KarenCH 33. KarenCH Lv 1 50 pts. 9,034
  4. Avatar for Blipperman 34. Blipperman Lv 1 49 pts. 9,024
  5. Avatar for YeshuaLives 35. YeshuaLives Lv 1 47 pts. 9,020
  6. Avatar for O Seki To 36. O Seki To Lv 1 46 pts. 9,010
  7. Avatar for Skippysk8s 37. Skippysk8s Lv 1 45 pts. 9,005
  8. Avatar for Deleted player 38. Deleted player 44 pts. 9,005
  9. Avatar for andrewxc 39. andrewxc Lv 1 43 pts. 9,004
  10. Avatar for lynnai 40. lynnai Lv 1 42 pts. 9,002

Comments