Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917
  1. Avatar for navn 131. navn Lv 1 3 pts. 8,752
  2. Avatar for greepski 132. greepski Lv 1 2 pts. 8,747
  3. Avatar for Altercomp 133. Altercomp Lv 1 2 pts. 8,735
  4. Avatar for hada 134. hada Lv 1 2 pts. 8,732
  5. Avatar for SouperGenious 135. SouperGenious Lv 1 2 pts. 8,719
  6. Avatar for Mike Cassidy 136. Mike Cassidy Lv 1 2 pts. 8,700
  7. Avatar for bamh 137. bamh Lv 1 2 pts. 8,683
  8. Avatar for ViJay7019 138. ViJay7019 Lv 1 2 pts. 8,660
  9. Avatar for Mengee 139. Mengee Lv 1 2 pts. 8,611
  10. Avatar for bhodg1 140. bhodg1 Lv 1 2 pts. 8,585

Comments