Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917

  1. Avatar for polly66017 181. polly66017 Lv 1 1 pt. 7,767
  2. Avatar for Pibeagles 182. Pibeagles Lv 1 1 pt. 7,764
  3. Avatar for Wheeler22 183. Wheeler22 Lv 1 1 pt. 7,703
  4. Avatar for boondog 184. boondog Lv 1 1 pt. 7,682
  5. Avatar for cthrek 185. cthrek Lv 1 1 pt. 7,643
  6. Avatar for aspadistra 186. aspadistra Lv 1 1 pt. 7,590
  7. Avatar for Radeodem8 187. Radeodem8 Lv 1 1 pt. 7,583
  8. Avatar for NotJim99 188. NotJim99 Lv 1 1 pt. 7,563
  9. Avatar for ivalnic 189. ivalnic Lv 1 1 pt. 7,558
  10. Avatar for Mike Lewis 190. Mike Lewis Lv 1 1 pt. 7,470

Comments