Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 81 pts. 9,884
  2. Avatar for Skippysk8s 12. Skippysk8s Lv 1 80 pts. 9,879
  3. Avatar for LociOiling 13. LociOiling Lv 1 78 pts. 9,852
  4. Avatar for bertro 14. bertro Lv 1 76 pts. 9,851
  5. Avatar for O Seki To 15. O Seki To Lv 1 75 pts. 9,844
  6. Avatar for Galaxie 16. Galaxie Lv 1 73 pts. 9,838
  7. Avatar for pauldunn 17. pauldunn Lv 1 71 pts. 9,834
  8. Avatar for Deleted player 18. Deleted player pts. 9,823
  9. Avatar for Mark- 19. Mark- Lv 1 68 pts. 9,818
  10. Avatar for actiasluna 20. actiasluna Lv 1 67 pts. 9,813

Comments