Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917
  1. Avatar for jermainiac 61. jermainiac Lv 1 24 pts. 9,616
  2. Avatar for smholst 62. smholst Lv 1 24 pts. 9,605
  3. Avatar for tarimo 63. tarimo Lv 1 23 pts. 9,604
  4. Avatar for BrKapr 64. BrKapr Lv 1 22 pts. 9,604
  5. Avatar for cbwest 65. cbwest Lv 1 22 pts. 9,593
  6. Avatar for stomjoh 66. stomjoh Lv 1 21 pts. 9,585
  7. Avatar for goastano 67. goastano Lv 1 21 pts. 9,580
  8. Avatar for YeshuaLives 68. YeshuaLives Lv 1 20 pts. 9,571
  9. Avatar for kitek314_pl 69. kitek314_pl Lv 1 20 pts. 9,530
  10. Avatar for gurch 70. gurch Lv 1 19 pts. 9,523

Comments