Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,530
  2. Avatar for It's over 9000! 12. It's over 9000! 2 pts. 9,238
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 9,027
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,969
  5. Avatar for freefolder 15. freefolder 1 pt. 8,735
  6. Avatar for xkcd 16. xkcd 1 pt. 8,568
  7. Avatar for Polska 17. Polska 1 pt. 7,809
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 7,590
  9. Avatar for Boinc.be 19. Boinc.be 1 pt. 7,428
  10. Avatar for CureCoin 20. CureCoin 1 pt. 6,917
  1. Avatar for dbuske 71. dbuske Lv 1 18 pts. 9,520
  2. Avatar for manu8170 72. manu8170 Lv 1 18 pts. 9,516
  3. Avatar for Paulo Roque 73. Paulo Roque Lv 1 17 pts. 9,512
  4. Avatar for diamonddays 74. diamonddays Lv 1 17 pts. 9,481
  5. Avatar for Glen B 75. Glen B Lv 1 16 pts. 9,454
  6. Avatar for Terafold 76. Terafold Lv 1 16 pts. 9,452
  7. Avatar for Deleted player 77. Deleted player pts. 9,441
  8. Avatar for silverberg 78. silverberg Lv 1 15 pts. 9,438
  9. Avatar for alwen 79. alwen Lv 1 15 pts. 9,435
  10. Avatar for eusair 80. eusair Lv 1 14 pts. 9,404

Comments