Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Team China 21. Team China 1 pt. 4,730

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,994
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 98 pts. 9,955
  3. Avatar for grogar7 3. grogar7 Lv 1 96 pts. 9,954
  4. Avatar for frood66 4. frood66 Lv 1 94 pts. 9,913
  5. Avatar for gmn 5. gmn Lv 1 92 pts. 9,906
  6. Avatar for Aubade01 6. Aubade01 Lv 1 91 pts. 9,895
  7. Avatar for mimi 7. mimi Lv 1 89 pts. 9,893
  8. Avatar for KarenCH 8. KarenCH Lv 1 87 pts. 9,892
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 85 pts. 9,890
  10. Avatar for gitwut 10. gitwut Lv 1 83 pts. 9,890

Comments