Placeholder image of a protein
Icon representing a puzzle

1184: Revisiting Puzzle 134: Rice

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
January 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Beta Folders 100 pts. 10,006
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,960
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 9,955
  4. Avatar for Contenders 4. Contenders 45 pts. 9,938
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,930
  6. Avatar for Go Science 6. Go Science 24 pts. 9,924
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 9,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 9,808
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,772
  10. Avatar for Deleted group 10. Deleted group pts. 9,703

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,994
  2. Avatar for Timo van der Laan 2. Timo van der Laan Lv 1 98 pts. 9,955
  3. Avatar for grogar7 3. grogar7 Lv 1 96 pts. 9,954
  4. Avatar for frood66 4. frood66 Lv 1 94 pts. 9,913
  5. Avatar for gmn 5. gmn Lv 1 92 pts. 9,906
  6. Avatar for Aubade01 6. Aubade01 Lv 1 91 pts. 9,895
  7. Avatar for mimi 7. mimi Lv 1 89 pts. 9,893
  8. Avatar for KarenCH 8. KarenCH Lv 1 87 pts. 9,892
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 85 pts. 9,890
  10. Avatar for gitwut 10. gitwut Lv 1 83 pts. 9,890

Comments