Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for Mass788 131. Mass788 Lv 1 3 pts. 8,382
  2. Avatar for Jesse Pinkman 132. Jesse Pinkman Lv 1 3 pts. 8,375
  3. Avatar for Altejos349 133. Altejos349 Lv 1 3 pts. 8,365
  4. Avatar for Hansie 134. Hansie Lv 1 3 pts. 8,355
  5. Avatar for decbin 135. decbin Lv 1 3 pts. 8,351
  6. Avatar for senor pit 136. senor pit Lv 1 3 pts. 8,340
  7. Avatar for bendbob 137. bendbob Lv 1 3 pts. 8,336
  8. Avatar for fiendish_ghoul 138. fiendish_ghoul Lv 1 3 pts. 8,330
  9. Avatar for tela 139. tela Lv 1 2 pts. 8,330
  10. Avatar for LuapNor 140. LuapNor Lv 1 2 pts. 8,313

Comments