Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820

  1. Avatar for Starlight36 161. Starlight36 Lv 1 1 pt. 8,161
  2. Avatar for GreekCivilization 162. GreekCivilization Lv 1 1 pt. 8,146
  3. Avatar for JCBio162 163. JCBio162 Lv 1 1 pt. 8,145
  4. Avatar for Pro Lapser 164. Pro Lapser Lv 1 1 pt. 8,144
  5. Avatar for momadoc 165. momadoc Lv 1 1 pt. 8,135
  6. Avatar for Nasalberry 166. Nasalberry Lv 1 1 pt. 8,074
  7. Avatar for AryehK 167. AryehK Lv 1 1 pt. 8,067
  8. Avatar for ImmortalAssassin 168. ImmortalAssassin Lv 1 1 pt. 8,047
  9. Avatar for chris.owens 169. chris.owens Lv 1 1 pt. 8,043
  10. Avatar for bgrassy 170. bgrassy Lv 1 1 pt. 8,029

Comments