Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for mirjamvandelft 191. mirjamvandelft Lv 1 1 pt. 7,668
  2. Avatar for kerpowah 192. kerpowah Lv 1 1 pt. 7,665
  3. Avatar for Wheeler22 193. Wheeler22 Lv 1 1 pt. 7,663
  4. Avatar for Radeodem8 194. Radeodem8 Lv 1 1 pt. 7,596
  5. Avatar for Kikaidkmek 195. Kikaidkmek Lv 1 1 pt. 7,577
  6. Avatar for opiorfina 196. opiorfina Lv 1 1 pt. 7,576
  7. Avatar for ribosomaltrilldank 197. ribosomaltrilldank Lv 1 1 pt. 7,568
  8. Avatar for ivalnic 198. ivalnic Lv 1 1 pt. 7,568
  9. Avatar for innatan221 199. innatan221 Lv 1 1 pt. 7,533
  10. Avatar for BeckerM 200. BeckerM Lv 1 1 pt. 7,531

Comments