Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for lamoille 201. lamoille Lv 1 1 pt. 7,516
  2. Avatar for Philippe_C 202. Philippe_C Lv 1 1 pt. 7,513
  3. Avatar for Khazgrim 203. Khazgrim Lv 1 1 pt. 7,481
  4. Avatar for Tac1 204. Tac1 Lv 1 1 pt. 7,466
  5. Avatar for parsnip 205. parsnip Lv 1 1 pt. 7,449
  6. Avatar for Pibeagles 206. Pibeagles Lv 1 1 pt. 7,444
  7. Avatar for Elijah Fasshauer 207. Elijah Fasshauer Lv 1 1 pt. 7,433
  8. Avatar for trebach 208. trebach Lv 1 1 pt. 7,419
  9. Avatar for demeter900 209. demeter900 Lv 1 1 pt. 7,409
  10. Avatar for joannaulanska 210. joannaulanska Lv 1 1 pt. 7,400

Comments