Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for Michaelb1029384 221. Michaelb1029384 Lv 1 1 pt. 7,299
  2. Avatar for blagdon 222. blagdon Lv 1 1 pt. 7,281
  3. Avatar for StpPls 223. StpPls Lv 1 1 pt. 7,270
  4. Avatar for terashig 224. terashig Lv 1 1 pt. 7,268
  5. Avatar for aspadistra 225. aspadistra Lv 1 1 pt. 7,241
  6. Avatar for Swarm_of_zerg 226. Swarm_of_zerg Lv 1 1 pt. 7,239
  7. Avatar for Perzik 227. Perzik Lv 1 1 pt. 7,236
  8. Avatar for zkm 228. zkm Lv 1 1 pt. 7,232
  9. Avatar for Jocal2016 229. Jocal2016 Lv 1 1 pt. 7,222
  10. Avatar for doctaven 230. doctaven Lv 1 1 pt. 7,210

Comments