Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for jchrisp 241. jchrisp Lv 1 1 pt. 6,135
  2. Avatar for packer 242. packer Lv 1 1 pt. 5,999
  3. Avatar for Nimbus13 243. Nimbus13 Lv 1 1 pt. 5,999
  4. Avatar for MeighMeigh 244. MeighMeigh Lv 1 1 pt. 5,999
  5. Avatar for rhassunuma 245. rhassunuma Lv 1 1 pt. 5,999
  6. Avatar for greepski 246. greepski Lv 1 1 pt. 5,999
  7. Avatar for penteplayer 247. penteplayer Lv 1 1 pt. 5,999
  8. Avatar for froggs554 248. froggs554 Lv 1 1 pt. 5,999
  9. Avatar for NDoughty 249. NDoughty Lv 1 1 pt. 5,999
  10. Avatar for Mike Cassidy 250. Mike Cassidy Lv 1 1 pt. 5,999

Comments