Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820

  1. Avatar for phi16 41. phi16 Lv 1 43 pts. 8,748
  2. Avatar for g_b 42. g_b Lv 1 42 pts. 8,747
  3. Avatar for Paulo Roque 43. Paulo Roque Lv 1 41 pts. 8,747
  4. Avatar for cobaltteal 44. cobaltteal Lv 1 40 pts. 8,746
  5. Avatar for O Seki To 45. O Seki To Lv 1 39 pts. 8,741
  6. Avatar for manu8170 46. manu8170 Lv 1 38 pts. 8,738
  7. Avatar for weitzen 47. weitzen Lv 1 37 pts. 8,735
  8. Avatar for diamond_dust 48. diamond_dust Lv 1 36 pts. 8,733
  9. Avatar for pmdpmd 49. pmdpmd Lv 1 35 pts. 8,733
  10. Avatar for Blipperman 50. Blipperman Lv 1 35 pts. 8,727

Comments