Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820

  1. Avatar for smholst 51. smholst Lv 1 34 pts. 8,727
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 33 pts. 8,721
  3. Avatar for isaksson 53. isaksson Lv 1 32 pts. 8,720
  4. Avatar for tarimo 54. tarimo Lv 1 31 pts. 8,720
  5. Avatar for Bletchley Park 55. Bletchley Park Lv 1 31 pts. 8,718
  6. Avatar for fishercat 56. fishercat Lv 1 30 pts. 8,717
  7. Avatar for eusair 57. eusair Lv 1 29 pts. 8,713
  8. Avatar for joremen 58. joremen Lv 1 28 pts. 8,711
  9. Avatar for Merf 59. Merf Lv 1 28 pts. 8,708
  10. Avatar for TomTaylor 60. TomTaylor Lv 1 27 pts. 8,701

Comments