Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820
  1. Avatar for drumpeter18yrs9yrs 61. drumpeter18yrs9yrs Lv 1 26 pts. 8,700
  2. Avatar for cherry39 62. cherry39 Lv 1 26 pts. 8,700
  3. Avatar for gurch 63. gurch Lv 1 25 pts. 8,689
  4. Avatar for shettler 64. shettler Lv 1 24 pts. 8,688
  5. Avatar for Glen B 65. Glen B Lv 1 24 pts. 8,685
  6. Avatar for caglar 66. caglar Lv 1 23 pts. 8,681
  7. Avatar for georg137 67. georg137 Lv 1 23 pts. 8,672
  8. Avatar for diamonddays 68. diamonddays Lv 1 22 pts. 8,672
  9. Avatar for jamiexq 69. jamiexq Lv 1 21 pts. 8,667
  10. Avatar for Bushman 70. Bushman Lv 1 21 pts. 8,662

Comments