Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 7 pts. 8,598
  2. Avatar for BOINC@Poland 12. BOINC@Poland 5 pts. 8,547
  3. Avatar for freefolder 13. freefolder 4 pts. 8,494
  4. Avatar for It's over 9000! 14. It's over 9000! 3 pts. 8,471
  5. Avatar for xkcd 15. xkcd 2 pts. 8,458
  6. Avatar for Deleted group 16. Deleted group pts. 8,414
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 8,393
  8. Avatar for JCBio162 18. JCBio162 1 pt. 8,145
  9. Avatar for TS Biology 19. TS Biology 1 pt. 8,029
  10. Avatar for Minions of TWIS 20. Minions of TWIS 1 pt. 7,820

  1. Avatar for jobo0502 71. jobo0502 Lv 1 20 pts. 8,660
  2. Avatar for MaartenDesnouck 72. MaartenDesnouck Lv 1 20 pts. 8,657
  3. Avatar for mitarcher 73. mitarcher Lv 1 19 pts. 8,648
  4. Avatar for SKSbell 74. SKSbell Lv 1 19 pts. 8,647
  5. Avatar for t012 75. t012 Lv 1 18 pts. 8,636
  6. Avatar for rg_sar 76. rg_sar Lv 1 18 pts. 8,635
  7. Avatar for Idiotboy 77. Idiotboy Lv 1 17 pts. 8,632
  8. Avatar for hansvandenhof 78. hansvandenhof Lv 1 17 pts. 8,632
  9. Avatar for Simek 79. Simek Lv 1 16 pts. 8,624
  10. Avatar for hallenberg 80. hallenberg Lv 1 16 pts. 8,623

Comments