Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for ScientificHetalians 21. ScientificHetalians 1 pt. 7,397
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 7,241
  3. Avatar for Boinc.be 23. Boinc.be 1 pt. 7,236
  4. Avatar for Team South Africa 24. Team South Africa 1 pt. 7,210
  5. Avatar for Ms. Carter's Jr. Science Classes 25. Ms. Carter's Jr. Science Classes 1 pt. 6,990
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 8,923
  2. Avatar for grogar7 2. grogar7 Lv 1 99 pts. 8,922
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 97 pts. 8,912
  4. Avatar for mimi 4. mimi Lv 1 95 pts. 8,907
  5. Avatar for KarenCH 5. KarenCH Lv 1 93 pts. 8,904
  6. Avatar for pauldunn 6. pauldunn Lv 1 91 pts. 8,902
  7. Avatar for crpainter 7. crpainter Lv 1 89 pts. 8,888
  8. Avatar for Timo van der Laan 8. Timo van der Laan Lv 1 87 pts. 8,882
  9. Avatar for gmn 9. gmn Lv 1 86 pts. 8,879
  10. Avatar for Museka 10. Museka Lv 1 84 pts. 8,877

Comments