Placeholder image of a protein
Icon representing a puzzle

1186: Revisiting Puzzle 135: E. coli

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
January 26, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 8,923
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 8,923
  3. Avatar for Contenders 3. Contenders 65 pts. 8,915
  4. Avatar for Go Science 4. Go Science 52 pts. 8,913
  5. Avatar for Void Crushers 5. Void Crushers 41 pts. 8,882
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 32 pts. 8,877
  7. Avatar for Gargleblasters 7. Gargleblasters 24 pts. 8,852
  8. Avatar for HMT heritage 8. HMT heritage 18 pts. 8,742
  9. Avatar for Deleted group 9. Deleted group pts. 8,721
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 10 pts. 8,662

  1. Avatar for 2017palvesdelima 231. 2017palvesdelima Lv 1 1 pt. 7,170
  2. Avatar for oliv.92 232. oliv.92 Lv 1 1 pt. 7,162
  3. Avatar for placid.lion 233. placid.lion Lv 1 1 pt. 7,071
  4. Avatar for doyoumath 234. doyoumath Lv 1 1 pt. 7,048
  5. Avatar for EastonSickels1234 235. EastonSickels1234 Lv 1 1 pt. 6,990
  6. Avatar for easmith7490 236. easmith7490 Lv 1 1 pt. 6,980
  7. Avatar for neelkprabhu 237. neelkprabhu Lv 1 1 pt. 6,950
  8. Avatar for Aldrovanda 238. Aldrovanda Lv 1 1 pt. 6,898
  9. Avatar for THATPOWER 239. THATPOWER Lv 1 1 pt. 6,854
  10. Avatar for serah29 240. serah29 Lv 1 1 pt. 6,243

Comments